Description

  • Product name

    Recombinant human IL-13 protein (Animal Free)
    See all IL-13 proteins and peptides
  • Biological activity

    Determined by its ability to stimulate the proliferation of Human TF-1 cells. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥1 x 106 units/mg.

  • Purity

    > 98 % SDS-PAGE.
    > 98% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAAL ESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKD LLLHLKKLFREGRFN
    • Predicted molecular weight

      13 kDa
    • Amino acids

      33 to 146

Specifications

Our Abpromise guarantee covers the use of ab217420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • Allergic rhinitis
    • ALRH
    • BHR 1
    • BHR1
    • Bronchial hyperresponsiveness 1 (bronchial asthma)
    • IL 13
    • IL-13
    • Il13
    • IL13_HUMAN
    • Interleukin 13
    • Interleukin-13
    • interleukin13
    • MGC116786
    • MGC116788
    • MGC116789
    • NC 30
    • NC30
    • P 600
    • P600
    see all
  • Function

    Cytokine (PubMed:8096327, PubMed:8097324). Inhibits inflammatory cytokine production (PubMed:8096327). Synergizes with IL2 in regulating interferon-gamma synthesis (PubMed:8096327). May be critical in regulating inflammatory and immune responses (PubMed:8096327, PubMed:8097324). Positively regulates IL31RA expression in macrophages.
  • Involvement in disease

    Allergic rhinitis
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab217420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up