Bioactive grade

Recombinant human IL-13 protein (Fc Chimera Active) (ab221410)

Description

  • Product name

    Recombinant human IL-13 protein (Fc Chimera Active)
    See all IL-13 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human IL-13RA1, His Tag at 10 μg/ml (100 μl/well) can bind ab221410 with a linear range of 0.256-10 μg/ml.

    Measured by its binding ability in a functional ELISA. Immobilized ab221410 at 10 μg/ml (100 μl/well) can bind Anti IL-13 MAb, Human IgG4 with a linear range of 0.8-25 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTA GMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIE VAQFVKDLLLHLKKLFREGQFN
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      25 to 146
    • Additional sequence information

      Fused with a human IgG1 Fc tag (Thr 106 - Lys 330; P01857) at the N-terminus. This product is the mature full length protein from aa 25 to 146. The signal peptide is not included (NP_002179.2).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab221410 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Allergic rhinitis
    • ALRH
    • BHR 1
    • BHR1
    • Bronchial hyperresponsiveness 1 (bronchial asthma)
    • IL 13
    • IL-13
    • Il13
    • IL13_HUMAN
    • Interleukin 13
    • Interleukin-13
    • interleukin13
    • MGC116786
    • MGC116788
    • MGC116789
    • NC 30
    • NC30
    • P 600
    • P600
    see all
  • Function

    Cytokine (PubMed:8096327, PubMed:8097324). Inhibits inflammatory cytokine production (PubMed:8096327). Synergizes with IL2 in regulating interferon-gamma synthesis (PubMed:8096327). May be critical in regulating inflammatory and immune responses (PubMed:8096327, PubMed:8097324). Positively regulates IL31RA expression in macrophages.
  • Involvement in disease

    Allergic rhinitis
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221410 stained overnight with Coomassie Blue.

    The protein migrates as 45-60 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

  • Immobilized Human IL-13RA1, His Tag at 10 μg/ml (100 μl/well) can bind ab221410 with a linear range of 0.256-10 μg/ml.

  • Immobilized ab221410 at 10 μg/ml (100 μl/well) can bind Anti IL-13 MAb, Human IgG4 with a linear range of 0.8-25 ng/ml.

References

This product has been referenced in:

  • Liu Z  et al. TGF-ß1 secreted by M2 phenotype macrophages enhances the stemness and migration of glioma cells via the SMAD2/3 signalling pathway. Int J Mol Med 42:3395-3403 (2018). Read more (PubMed: 30320350) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221410.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up