Recombinant human IL-13 receptor alpha 1 protein (ab167745)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human IL-13 receptor alpha 1 protein
See all IL-13 receptor alpha 1 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized rhIL13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL13 with a linear range of 0.1-10 ng/mL. -
Purity
> 98 % SDS-PAGE.
ab167745 was lyophilized from 0.22 µm filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFG DKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPP EGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIH QCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVP LTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTET HNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCY EDDKLWSNWSQEMSIGKKRNST -
Predicted molecular weight
38 kDa including tags -
Amino acids
22 to 343 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab167745 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Measured by its binding ability in a functional ELISA. Immobilized rhIL-13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL-13 with a linear range of 0.1-10 ng/mL.
Please contact our Scientific Support team for lot-specific reconstitution instructions.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 94% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- bB128O4.2.1 (interleukin 13 receptor, alpha 1)
- Cancer/testis antigen 19
- CD213a1
see all -
Function
Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity. -
Tissue specificity
Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 5 subfamily. -
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Human IL-13 R alpha 1, His Tag (SPR verified) captured on CM5 chip via anti-His antibody can bind Human IL-13 with an affinity constant of 16 nM as determined in a SPR assay (Biacore T200).
-
SDS-PAGE analysis of reduced ab167745 and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 55-65 kDa in SDS-PAGE due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab167745 has not yet been referenced specifically in any publications.