Recombinant human IL-13 receptor alpha 1 protein (ab167745)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant human IL-13 receptor alpha 1 protein
See all IL-13 receptor alpha 1 proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceHEK 293 cells
-
Amino Acid Sequence
-
Accession
-
SpeciesHuman
-
SequenceGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFG DKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPP EGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIH QCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVP LTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTET HNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCY EDDKLWSNWSQEMSIGKKRNST
-
Molecular weight38 kDa including tags
-
Amino acids22 to 343
-
TagsHis tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab167745 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Biological activityMeasured by its binding ability in a functional ELISA. Immobilized rhIL13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL13 with a linear range of 0.1-10 ng/mL.
-
Applications
Functional Studies
SDS-PAGE
-
Endotoxin level< 1.000 Eu/µg
-
Purity> 98 % SDS-PAGE.
ab167745 was lyophilized from 0.22 µm filtered solution. -
FormLyophilised
-
Additional notes
Measured by its binding ability in a functional ELISA. Immobilized rhIL-13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL-13 with a linear range of 0.1-10 ng/mL.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 94% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- bB128O4.2.1 (interleukin 13 receptor, alpha 1)
- Cancer/testis antigen 19
- CD213a1
see all -
FunctionBinds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity.
-
Tissue specificityUbiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
-
Sequence similaritiesBelongs to the type I cytokine receptor family. Type 5 subfamily.
-
DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation. -
Cellular localizationMembrane.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant human IL-13 receptor alpha 1 protein (ab167745)SDS-PAGE analysis of reduced ab167745 and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 55-65 kDa in SDS-PAGE due to glycosylation.
Datasheets and documents
References
ab167745 has not yet been referenced specifically in any publications.
