For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-il-13-receptor-alpha-1-protein-ab167745.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Cytokines Interleukins
Share by email
Bioactive grade

Recombinant human IL-13 receptor alpha 1 protein (ab167745)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
  • SDS-PAGE - Recombinant human IL-13 receptor alpha 1 protein (ab167745)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 98% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

ELISA
Product image
Human IL-13 RA1 ELISA Kit (ab267620)

View more associated products

Description

  • Product name

    Recombinant human IL-13 receptor alpha 1 protein
    See all IL-13 receptor alpha 1 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized rhIL13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL13 with a linear range of 0.1-10 ng/mL.
  • Purity

    > 98 % SDS-PAGE.
    ab167745 was lyophilized from 0.22 µm filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P78552
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFG DKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPP EGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIH QCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVP LTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTET HNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCY EDDKLWSNWSQEMSIGKKRNST
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      22 to 343
    • Tags

      His tag C-Terminus

Associated products

  • Related Products

    • Anti-IL-13 receptor alpha 1 antibody (ab108499)
    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab167745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilized
  • Additional notes

    Measured by its binding ability in a functional ELISA. Immobilized rhIL-13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL-13 with a linear range of 0.1-10 ng/mL.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • bB128O4.2.1 (interleukin 13 receptor, alpha 1)
    • Cancer/testis antigen 19
    • CD213a1
    • CD213A1 Antigen
    • CT 19
    • CT19
    • I13R1_HUMAN
    • IL 13 receptor subunit alpha 1
    • IL 13R alpha 1
    • IL 13R subunit alpha 1
    • IL 13Ra
    • IL 13RA1
    • IL-13 receptor subunit alpha-1
    • IL-13R subunit alpha-1
    • IL-13R-alpha-1
    • IL-13RA1
    • IL13 receptor alpha 1 chain
    • IL13R
    • IL13RA
    • Il13ra1
    • Interleukin 13 receptor alpha 1
    • Interleukin 13 receptor alpha 1 chain
    • interleukin 13 receptor subunit alpha 1
    • Interleukin-13 receptor subunit alpha-1
    • NR 4
    • NR4
    see all
  • Function

    Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity.
  • Tissue specificity

    Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession P78552 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    Functional Studies - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    Human IL-13 R alpha 1, His Tag (SPR verified) captured on CM5 chip via anti-His antibody can bind Human IL-13 with an affinity constant of 16 nM as determined in a SPR assay (Biacore T200).
  • SDS-PAGE - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    SDS-PAGE - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    SDS-PAGE analysis of reduced ab167745 and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 55-65 kDa in SDS-PAGE due to glycosylation.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab167745? Please let us know so that we can cite the reference in this datasheet.

    ab167745 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab167745.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.