Bioactive grade

Recombinant human IL-13 receptor alpha 1 protein (ab167745)

Submit a review Submit a question
Functional Studies - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
  • SDS-PAGE - Recombinant human IL-13 receptor alpha 1 protein (ab167745)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 98% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

Description

  • Product name

    Recombinant human IL-13 receptor alpha 1 protein
    See all IL-13 receptor alpha 1 proteins and peptides

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized rhIL13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL13 with a linear range of 0.1-10 ng/mL.

  • Purity

    > 98 % SDS-PAGE.
    ab167745 was lyophilized from 0.22 µm filtered solution.

  • Endotoxin level

    < 1.000 Eu/µg

  • Expression system

    HEK 293 cells

  • Accession

    P78552

  • Protein length

    Protein fragment

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Human

    • Sequence

      GGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFG DKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPP EGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIH QCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVP LTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFISRCLFYEVEVNNSQTET HNVFYVQEAKCENPEFERNVENTSCFMVPGVLPDTLNTVRIRVKTNKLCY EDDKLWSNWSQEMSIGKKRNST

    • Predicted molecular weight

      38 kDa including tags

    • Amino acids

      22 to 343

    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilized

  • Additional notes

    Measured by its binding ability in a functional ELISA. Immobilized rhIL-13 receptor alpha 1 at 2 µg/mL (100 µL/well) can bind rhIL-13 with a linear range of 0.1-10 ng/mL.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 94% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • bB128O4.2.1 (interleukin 13 receptor, alpha 1)
    • Cancer/testis antigen 19
    • CD213a1
    • CD213A1 Antigen
    • CT 19
    • CT19
    • I13R1_HUMAN
    • IL 13 receptor subunit alpha 1
    • IL 13R alpha 1
    • IL 13R subunit alpha 1
    • IL 13Ra
    • IL 13RA1
    • IL-13 receptor subunit alpha-1
    • IL-13R subunit alpha-1
    • IL-13R-alpha-1
    • IL-13RA1
    • IL13 receptor alpha 1 chain
    • IL13R
    • IL13RA
    • Il13ra1
    • Interleukin 13 receptor alpha 1
    • Interleukin 13 receptor alpha 1 chain
    • interleukin 13 receptor subunit alpha 1
    • Interleukin-13 receptor subunit alpha-1
    • NR 4
    • NR4
    see all

  • Function

    Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but cannot replace the function of IL2RG in allowing enhanced interleukin-2 (IL2) binding activity.

  • Tissue specificity

    Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.

  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.

  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.

  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Functional Studies - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    Functional Studies - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    Human IL-13 R alpha 1, His Tag (SPR verified) captured on CM5 chip via anti-His antibody can bind Human IL-13 with an affinity constant of 16 nM as determined in a SPR assay (Biacore T200).
  • SDS-PAGE - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    SDS-PAGE - Recombinant human IL-13 receptor alpha 1 protein (ab167745)
    SDS-PAGE analysis of reduced ab167745 and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 55-65 kDa in SDS-PAGE due to glycosylation.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab167745? Please let us know so that we can cite the reference in this datasheet.

ab167745 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab167745.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com