Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNI GSETWKTIIT KNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWA ETTYWISPQGIPETKVQDMDCV YYNWQYLLCSWKPGIGVLLDTNYNLF YWYEGLDHALQCVDYIKADGQNIGCRFPYLEASD YKDFYICVNGSSEN KPIRSSYFTFQLQNIVKPLPPVYLTFTRESSCEIKLKWSIPLGPIP AR CFDYEIEIREDDTTLVTATVENETYTLKTTNETRQLCFVVRSKVNIYCSD DGIWSEWS DKQCWEGEDLSKKTLL
    • Molecular weight
      63 kDa including tags
    • Amino acids
      27 to 342

Associated products

Specifications

Our Abpromise guarantee covers the use of ab155612 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IL13RA2 at 8 µg/ml (100 µl/well) can bind IL13 with a linear range of 0.25 - 10 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.

  • Form
    Lyophilised
  • Additional notes

    Measured by its binding ability in a functional ELISA. Immobilized recombinant Human IL-13RA2 at 8 µg/ml (100 µl/well) can bind IL-13 with a linear range of 0.25 - 10 ng/ml.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.00
    Constituents: 5% Trehalose, 0.75% Glycine, 0.605% Tris

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile PBS to a final concentration of 200 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • Cancer/testis antigen 19
    • CD213a2
    • CT19
    • I13R2_HUMAN
    • IL-13 receptor subunit alpha-2
    • IL-13R subunit alpha-2
    • IL-13R-alpha-2
    • IL-13RA2
    • IL13 receptor
    • IL13BP
    • IL13R
    • Il13ra2
    • Interleukin 13 binding protein
    • Interleukin 13 receptor alpha 2 chain
    • Interleukin-13 receptor subunit alpha-2
    • Interleukin-13-binding protein
    see all
  • Function
    Binds as a monomer with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4).
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 5 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab155612 stained overnight with Coomassie Blue.

References

ab155612 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155612.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up