Description

  • Product name

    Recombinant human IL-15 protein (Animal Free)
    See all IL-15 proteins and peptides
  • Biological activity

    Determined by its ability to stimulate the proliferation of mouse CTLL-2 cells. The expected ED50 is ≤ 0.5 ng/ml, corresponding to a specific activity of ≥2 x 106 units/mg.

  • Purity

    > 98 % SDS-PAGE.
    > 98% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQV ISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEF LQSFVHIVQMFINTS
    • Predicted molecular weight

      13 kDa
    • Amino acids

      49 to 162
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide and propeptide are not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab217421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • IL 15
    • IL-15
    • IL15
    • IL15_HUMAN
    • Interleukin 15
    • Interleukin-15
    • Interleukin15
    • MGC9721
    see all
  • Function

    Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
  • Tissue specificity

    Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.
  • Sequence similarities

    Belongs to the IL-15/IL-21 family.
  • Cellular localization

    Secreted and Cytoplasm. Nucleus. IL15-S21AA is not secreted, but rather is stored intracellularly, appearing in the nucleus and cytoplasmic components.
  • Information by UniProt

References

ab217421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up