Description

  • Product name

    Recombinant Human IL-17A protein
    See all IL-17A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab201893 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/mg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSP WNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLR REPPHCPNSFRLEKILVSVGCTCVTPIVHH VAHHHHHH
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      24 to 155
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.033% EDTA, 0.00174% PMSF, 79% PBS, 20% Glycerol

General Info

  • Alternative names

    • CTLA 8
    • CTLA-8
    • CTLA8
    • cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • interleukin 17A
    • Interleukin-17A
    • interleukin17
    • Interleukin17A
    • OTTHUMP00000016597
    • OTTMUSP00000046003
    see all
  • Function

    Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Tissue specificity

    Restricted to activated memory T-cells.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Post-translational
    modifications

    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201893 (3μg).

    MW: 13.5-28kDa (SDS–PAGE under reducing conditions.)

References

ab201893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up