Description

  • Product name

    Recombinant human IL-17A protein (Active)
    See all IL-17A proteins and peptides
  • Biological activity

    Production of IL-6 from mouse NIH/3T3 cells. ≤10 ng/mL; ≥ 1.0 x 105 units/mg.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYN RSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQE ILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
    • Predicted molecular weight

      16 kDa
    • Amino acids

      21 to 155

Specifications

Our Abpromise guarantee covers the use of ab256041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at room temperature. Store at -20°C.

    Constituent: 0.1% Trifluoroacetic acid

    0.2 micron filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile water to 0.1 mg/ml, Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • CTLA 8
    • CTLA-8
    • CTLA8
    • cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • interleukin 17A
    • Interleukin-17A
    • interleukin17
    • Interleukin17A
    • OTTHUMP00000016597
    • OTTMUSP00000046003
    see all
  • Function

    Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Tissue specificity

    Restricted to activated memory T-cells.
  • Sequence similarities

    Belongs to the IL-17 family.
  • Post-translational
    modifications

    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab256041 (1μg) under non-reducing (Lane 1) and reducing (Lane 2) conditions. ab256041 is a homodimer with predicted to have a MW of 31.3 kDa.

    4-20% Tris-Glycine gel. Coomassie Blue staining.

  • Functional analysis of ab256041.

References

ab256041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab256041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up