Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMN VSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGG
    • Amino acids
      18 to 117
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRL 4
    • CRL4
    • Cytokine receptor CRL4
    • EVI 27
    • EVI27
    • IL 17 receptor B
    • IL 17 receptor homolog 1
    • IL 17B receptor
    • IL 17RB
    • IL 17Rh1
    • IL17B Receptor
    • IL17BR
    • IL17RB
    • IL17RH1
    • Interleukin 17 receptor B
    • Interleukin 17 receptor homolog
    • Interleukin 17 receptor homolog 1
    • Interleukin 17B receptor
    • MGC5245
    see all
  • Relevance
    Recently, a number of cytokines belonging to the interleukin IL-17 family have been identified. These are termed as IL-17B, IL-17C and IL-17E. IL-17 is a potent proinflammatory cytokine that plays roles in a number of diseases including rheumatoid arthritis, multiple sclerosis, and promotion of tumor growth. IL-17B, C, and E like IL-17 are able to induce proinflammatory responses. However, they do not bind to the IL-17 receptor suggesting that additional IL-17R related receptor might exist. Receptor for IL-17B and IL-17E have been independently isolated and have been designated as EV127 (in mouse) and IL-17RH1 (in human), respectively. IL-17E induces activation of NFkB pathway and like IL-17 also induces production of IL-8. IL-17RH1 mRNA is highly expressed in Kidney and liver and at moderate level in small intestine, colon, and brain.
  • Cellular localization
    Type I membrane protein (isoform 1). Secreted (isoform 2).

Images

  • ab163120 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up