Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRST SPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLV VRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
    • Molecular weight

      15 kDa
    • Amino acids

      31 to 163
    • Additional sequence information

      Full length mature chain without signal peptide. Source: Genetically modified E.coli.

Specifications

Our Abpromise guarantee covers the use of ab238296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Production of IL-6 from mouse 3T3 cells ≤100 ng/mL; ≥ 1.0 x 10^4 units/mg.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    <=1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • CANDF6
    • Cytokine ML 1
    • Cytokine ML-1
    • IL 17F
    • IL 24
    • IL-17F
    • IL-24
    • Il17f
    • IL17F_HUMAN
    • Interleukin 17F
    • Interleukin 24
    • Interleukin-17F
    • Interleukin-24
    • ML 1
    • ML1
    • Mutant IL 17F
    • OTTHUMP00000016602
    see all
  • Function

    Ligand for IL17RA and IL17RC (PubMed:17911633). The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC (PubMed:18684971). Involved in stimulating the production of other cytokines such as IL6, IL8 and CSF2, and in regulation of cartilage matrix turnover (PubMed:11591732, PubMed:11591768, PubMed:11574464). Also involved in stimulating the proliferation of peripheral blood mononuclear cells and T-cells and in inhibition of angiogenesis (PubMed:11591732). Plays a role in the induction of neutrophilia in the lungs and in the exacerbation of antigen-induced pulmonary allergic inflammation.
  • Tissue specificity

    Expressed in activated, but not resting, CD4+ T-cells and activated monocytes.
  • Involvement in disease

    Candidiasis, familial, 6
  • Sequence similarities

    Belongs to the IL-17 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Recombinant human IL17F protein (Active) (ab238296) used at 1 µg.

    4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

  • Production of IL-6 from mouse 3T3 cells ≤100 ng/mL; ≥ 1.0 x 10^4 units/mg.

References

ab238296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238296.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up