Recombinant Human IL-17RA protein (ab161762)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTPSSPKDLQIQLHF AHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFL
    • Amino acids
      33 to 132
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161762 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CANDF5
    • CD217
    • CD217 antigen
    • CDw217
    • CTLA8
    • HIL 17R
    • hIL17R
    • I17RA_HUMAN
    • IL 17 receptor
    • IL 17 receptor A
    • IL 17RA
    • IL-17 receptor A
    • IL-17RA
    • IL17
    • IL17A receptor
    • IL17R
    • IL17RA
    • IMD51
    • Interleukin 17 receptor A
    • Interleukin-17 receptor A
    • MGC10262
    see all
  • Function
    Receptor for IL17A and IL17F. Binds its IL17A ligand with low affinity, suggesting that additional components are involved in IL17A-induced signaling.
  • Tissue specificity
    Widely expressed.
  • Involvement in disease
    Defects in IL17RA are the cause of familial candidiasis type 5 (CANDF5) [MIM:613953]. CANDF5 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
  • Sequence similarities
    Contains 1 SEFIR domain.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161762 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161762 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161762.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up