Bioactive grade

Recombinant human IL-17RA Receptor protein (Fc Chimera Active) (ab221025)

Description

  • Product name

    Recombinant human IL-17RA Receptor protein (Fc Chimera Active)
    See all IL-17RA Receptor proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human IL17/IL17A,Tag Free at 2 μg/mL (100 μL/well ) can bind ab221025 with a linear ranger of 0.3 - 5 ng/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LRLLDHRALVCSQPGLNCTVKNSTCLDDSWIHPRNLTPSSPKDLQIQLHF AHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLNTNERLCVRFEFL SKLRHHHRRWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNFLV PDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQI LLTSFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQ IQPFFSSCLNDCLRHSATVSCPEMPDTPEPIPDYMPLW
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      33 to 320
    • Additional sequence information

      This protein carries a human IgG1 Fc tag at the C-terminus. (NP_055154.3).

Specifications

Our Abpromise guarantee covers the use of ab221025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 5% Trehalose, 0.75% Glycine, 0.06% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CANDF5
    • CD217
    • CD217 antigen
    • CDw217
    • CTLA8
    • HIL 17R
    • hIL17R
    • I17RA_HUMAN
    • IL 17 receptor
    • IL 17 receptor A
    • IL 17RA
    • IL-17 receptor A
    • IL-17RA
    • IL17
    • IL17A receptor
    • IL17R
    • IL17RA
    • IMD51
    • Interleukin 17 receptor A
    • Interleukin-17 receptor A
    • MGC10262
    see all
  • Function

    Receptor for IL17A and IL17F. Binds its IL17A ligand with low affinity, suggesting that additional components are involved in IL17A-induced signaling.
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Defects in IL17RA are the cause of familial candidiasis type 5 (CANDF5) [MIM:613953]. CANDF5 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
  • Sequence similarities

    Contains 1 SEFIR domain.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221025 stained overnight with Coomassie Blue.

    The protein migrates as 71-90 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

  • Immobilized Human IL17/IL17A,Tag Free at 2 μg/mL (100 μL/well ) can bind ab221025 with a linear ranger of 0.3 - 5 ng/mL.

References

ab221025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up