Description

  • Product name

    Recombinant Human IL-17RB protein
    See all IL-17RB proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab202167 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMN VSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGG KWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPGCLDHIM KYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMALIQHSTII GFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGT VVLCPQTGVPFPLDNNKSKPGGWLPVEPKSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKT KPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKA KGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGKHHHHHH
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      18 to 292
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus (NP_061195).

Specifications

Our Abpromise guarantee covers the use of ab202167 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as IL-17B Receptor

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • CRL 4
    • CRL4
    • Cytokine receptor CRL4
    • EVI 27
    • EVI27
    • IL 17 receptor B
    • IL 17 receptor homolog 1
    • IL 17B receptor
    • IL 17RB
    • IL 17Rh1
    • IL17B Receptor
    • IL17BR
    • IL17RB
    • IL17RH1
    • Interleukin 17 receptor B
    • Interleukin 17 receptor homolog
    • Interleukin 17 receptor homolog 1
    • Interleukin 17B receptor
    • MGC5245
    see all
  • Relevance

    Recently, a number of cytokines belonging to the interleukin IL-17 family have been identified. These are termed as IL-17B, IL-17C and IL-17E. IL-17 is a potent proinflammatory cytokine that plays roles in a number of diseases including rheumatoid arthritis, multiple sclerosis, and promotion of tumor growth. IL-17B, C, and E like IL-17 are able to induce proinflammatory responses. However, they do not bind to the IL-17 receptor suggesting that additional IL-17R related receptor might exist. Receptor for IL-17B and IL-17E have been independently isolated and have been designated as EV127 (in mouse) and IL-17RH1 (in human), respectively. IL-17E induces activation of NFkB pathway and like IL-17 also induces production of IL-8. IL-17RH1 mRNA is highly expressed in Kidney and liver and at moderate level in small intestine, colon, and brain.
  • Cellular localization

    Type I membrane protein (isoform 1). Secreted (isoform 2).

Images

  • 15% SDS-PAGE analysis of 3 µg ab202167.

     

    MWt 50-70KDa (SDS–PAGE under reducing conditions).

References

ab202167 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202167.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up