Description

  • Product name

    Recombinant Human IL-17RC protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPGLSCRLWDSDILCLP GDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPE DEEKFGGAADSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQ FGQSVGSVVYDCFEAALGSEVRIWSYTQPRYEKELNHTQQLPALPWLNVS ADGDNVHLVLNVSEEQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHT DLVPCLCIQVWPLEPDSVRTNICPFREDPRAHQNLWQAARLRLLTLQSWL LDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWENVTVDKVLEFPLLKGHP NLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSLCALEPS GCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIH KRWALVWLACLLFAAALSLILLLKKDHAKGWLRLLKQDVRSGGEWEQALG GGPPPGSQACASSPLPSPSVFSGSGRQGPRGSAPLLSR
    • Amino acids

      1 to 538
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • IL 17 receptor C
    • IL 17RC
    • IL 17RL
    • IL17 receptor C
    • IL17F receptor
    • IL17RC
    • IL17RL
    • Interleukin 17 receptor C
    • Interleukin 17 receptor homolog
    • Interleukin 17 receptor like
    • Interleukin 17 receptor like protein
    see all
  • Relevance

    IL-17RC is a single pass transmembrane protein that shares limited similarity with the interleukin 17 receptor. It is widely expressed in non leukocyte tissues and forms a heteromeric receptor for IL-17 with IL-17RA. At least four different isoforms are known to exist.
  • Cellular localization

    Cell membrane; Single pass type I membrane protein. Note: soluble isoforms may be produced.

Images

  • ab164665 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up