Description

  • Product name

    Recombinant Human IL-18 protein (His tag)
    See all IL-18 proteins and peptides
  • Purity

    >= 97 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIIS MYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMNPPDNIKDTKSDII FFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIM FTVQNED
    • Amino acids

      37 to 193
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without propeptide.

Specifications

Our Abpromise guarantee covers the use of ab214557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstituted in sterile H2O not less than 100 µg/mL, which can then be further diluted in other aqueous solutions. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • Iboctadekin
    • IFN gamma inducing factor
    • IFN-gamma-inducing factor
    • IGIF
    • IL 1 gamma
    • IL 18
    • IL 1g
    • IL-1 gamma
    • IL-18
    • IL1 gamma
    • IL18
    • IL18 protein
    • IL18_HUMAN
    • IL1F4
    • IL1g
    • IL1gamma
    • ILIF4
    • Interferon gamma inducing factor
    • Interferon gamma-inducing factor
    • Interleukin 1 gamma
    • Interleukin 18
    • Interleukin 18 (interferon-gamma-inducing factor)
    • Interleukin-1 gamma
    • Interleukin-18
    • Interleukin18
    • MGC12320
    see all
  • Function

    Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
  • Sequence similarities

    Belongs to the IL-1 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up