Description

  • Product name

    Recombinant Human IL-18BP protein (Fc Chimera His Tag)
    See all IL-18BP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222958 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPTPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVP LNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTG TQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLP PTQEALPSSHSSPQQQGLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK HHHHHH
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      31 to 194
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused to hIgG-His-tag at C-terminus. This product is the mature full length protein from aa 31 to 194. The signal peptide is not included (NP_001138529).

Specifications

Our Abpromise guarantee covers the use of ab222958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • I18BP_HUMAN
    • IL-18BP
    • IL18 binding protein
    • IL18 BP
    • IL18 BPa
    • IL18BP
    • IL18BPa
    • Interleukin 18 binding protein
    • Interleukin-18-binding protein
    • MC51L 53L 54L homolog gene product
    • Tadekinig alfa
    • Tadekinig-alfa
    see all
  • Function

    Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
  • Tissue specificity

    Strongly expressed in heart, lung, placenta and spleen.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222958.

    MWt 40-57 kDa (SDS-PAGE under reducing conditions) .

References

ab222958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up