Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNG TLSLSCVACS RFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGT QLCKALVLEQLTPALHSTNFSC VLVDPEQVVQRHVVLAQLWAGLRATL PPTQEALPSSHSSPQQQG
    • Molecular weight

      19 kDa including tags
    • Amino acids

      31 to 194
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. (NP_001138529) .

Specifications

Our Abpromise guarantee covers the use of ab221201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • I18BP_HUMAN
    • IL-18BP
    • IL18 binding protein
    • IL18 BP
    • IL18 BPa
    • IL18BP
    • IL18BPa
    • Interleukin 18 binding protein
    • Interleukin-18-binding protein
    • MC51L 53L 54L homolog gene product
    • Tadekinig alfa
    • Tadekinig-alfa
    see all
  • Function

    Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.
  • Tissue specificity

    Strongly expressed in heart, lung, placenta and spleen.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab221201 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 28-48 kDa in SDS-PAGE due to glycosylation.

References

ab221201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up