Recombinant Human IL-18R Beta/IL-18RAP protein (Fc Chimera His Tag) (ab227393)

Description

  • Product name

    Recombinant Human IL-18R Beta/IL-18RAP protein (Fc Chimera His Tag)
    See all IL-18R Beta/IL-18RAP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab227393 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPE HLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVN NSGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGS TGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTY VCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPL TISCKARFGFERVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIER NIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRLEPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSV MHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      65 kDa including tags
    • Amino acids

      20 to 356
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus (NP_003844).

Specifications

Our Abpromise guarantee covers the use of ab227393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as IL-18R Beta

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • IL18RAP
    • Accessory protein like
    • Accessory protein-like
    • AcPL
    • CD218 antigen-like family member B
    • CD218b
    • CDw218b
    • I18RA_HUMAN
    • IL 18RAcP
    • IL 1R accessory protein like
    • IL 1R7
    • IL 1RAcPL
    • IL-18 receptor accessory protein
    • IL-18R-beta
    • IL-18RAcP
    • IL-18Rbeta
    • IL-1R accessory protein-like
    • IL-1R-7
    • IL-1R7
    • IL-1RAcPL
    • IL18R Beta
    • IL18RAP
    • IL18Rbeta
    • Interleukin 18 receptor accessory protein
    • Interleukin-1 receptor 7
    • Interleukin-18 receptor accessory protein
    • Interleukin-18 receptor accessory protein-like
    • Interleukin-18 receptor beta
    • Interleukin-18 receptor beta chain
    see all
  • Function

    Required for the high affinity binding of interleukin 18 (IL-18) to its receptor complex (By similarity). Together with IL18R1 mediates IL-18-dependent activation of NF-kappa-B and JNK.
  • Tissue specificity

    Strongly expressed in peripheral blood leukocytes, spleen, lung, and, to a lesser extent, in colon, but not in any other tissue tested. Strongly expressed in T-cells polarized with IL-12. Specifically coexpressed with IL18R1 in Th1 cells.
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227393.

    MW: 70-100 kDa (SDS-PAGE under reducing conditions).

References

ab227393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up