Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSP RINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNA SYCDKMSIELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKT DVKIQWYKDSLLLDKDNEKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAH EGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSRLTIPCKVFLG TGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSENNENYIEVPLIFD PVTREDLHMDFKCVVHNTLSFQTLRTTVKELEHHHHHH
    • Molecular weight

      39 kDa including tags
    • Amino acids

      14 to 343
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_004624).

Specifications

Our Abpromise guarantee covers the use of ab229356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to inhibit proliferation using D10.G4.1 mouse helper T cells. The ED50 for this effect is less or equal to 400 ng/ml with IL-1beta.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab229356 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as IL1 Receptor II.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • IL1 Receptor II
    • Antigen CDw121b
    • CD121
    • CD121 antigen-like family member B
    • CD121b
    • CD121B Antigen
    • CDw121b
    • IL 1 type II receptor
    • IL-1R-2
    • IL-1R-beta
    • IL-1R2
    • IL-1RT-2
    • IL-1RT2
    • IL1R Beta
    • Il1r-2
    • IL1R2
    • IL1R2_HUMAN
    • IL1R2c
    • IL1RB
    • Interleukin 1 receptor type II variant 3
    • Interleukin 1 receptor, beta, type II
    • Interleukin 1 receptor, type II
    • Interleukin-1 receptor beta
    • Interleukin-1 receptor type 2
    • Interleukin-1 receptor type II
    • MGC137383
    • MGC47725
    • OTTHUMP00000207969
    • p68
    • Type II interleukin-1 receptor, beta
    see all
  • Function

    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1ra).
  • Sequence similarities

    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229356.

    MW: 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab229356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up