Recombinant Human IL-1RAcP protein (ab151831)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human IL-1RAcP protein
See all IL-1RAcP proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab151831 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It was lyophilized from an 0.2 µM filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSS VKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENG RTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYF SFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKK VTSEDLKRSYVCHARSAKGEVAKAAKVKQKGNRCGQ -
Predicted molecular weight
40 kDa including tags -
Amino acids
21 to 356 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab151831 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Store at +4°C short term (1-2 weeks). Store at -20°C long term. Working aliquots stored with a carrier protein are stable for at least 3 months at -20°C to -80°C..
pH: 7.20
Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride -
ReconstitutionDissolve the lyophilized protein in 1X PBS.
It is not recommended to reconstitute to a concentration less than 100 µg/ml.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- C3orf13
- FLJ37788
- IL 1 receptor accessory protein
see all -
Function
Coreceptor with IL1R1. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. -
Tissue specificity
Detected in liver, skin, placenta, thymus and lung. -
Sequence similarities
Belongs to the interleukin-1 receptor family.
Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
Contains 1 TIR domain. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab151831 has not yet been referenced specifically in any publications.