Bioactive grade

Recombinant human IL-1ra/IL-1F3 protein (Active) (ab243764)

Description

  • Product name

    Recombinant human IL-1ra/IL-1F3 protein (Active)
    See all IL-1ra/IL-1F3 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 40 ng/ml, corresponding to a specific activity of >2.5x104 IU/mg in the presence of 50 pg/ml rHuIL-1α.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVP IEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAF IRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQE DE
    • Predicted molecular weight

      17 kDa
    • Amino acids

      26 to 177
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20degC. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • DIRA
    • ICIL 1RA
    • IL 1ra
    • IL 1ra3
    • IL 1RN
    • IL1 inhibitor
    • IL1F3
    • IL1RA
    • IL1RN
    • IL1RN (IL1F3)
    • interleukin 1 receptor antagonist
    • interleukin 1 receptor antagonist protein
    • intracellular IL 1 receptor antagonist type II
    • intracellular interleukin 1 receptor antagonist (icIL 1ra)
    • IRAP
    • MVCD4
    • type II interleukin 1 receptor antagonist
    see all
  • Relevance

    Function Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure. Tissue specificity The intracellular form of IL1RN is predominantly expressed in epithelial cells. Involvement in disease Genetic variation in IL1RN is associated with susceptibility to microvascular complications of diabetes type 4 (MVCD4) [MIM:612628]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Defects in IL1RN are the cause of interleukin 1 receptor antagonist deficiency (DIRA) [MIM:612852]; also known as deficiency of interleukin 1 receptor antagonist. Autoinflammatory diseases manifest inflammation without evidence of infection, high-titer autoantibodies, or autoreactive T-cells. DIRA is a rare, autosomal recessive, genetic autoinflammatory disease that results in sterile multifocal osteomyelitis (bone inflammation in multiple places), periostitis (inflammation of the membrane surrounding the bones), and pustulosis (due to skin inflammation) from birth. Pharmaceutical use Available under the name Kineret (Amgen). Used for the reduction in signs and symptoms and slowing the progression of structural damage in moderately to severely active rheumatoid arthritis.
  • Cellular localization

    Cytoplasmic (isoforms 2, 3 and 4)and Secreted (isoform 1)

Images

  • SDS Page analysis of IL-1ra/IL-1F3 with ab243764.

References

ab243764 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up