Overview

  • Product name
    Recombinant Human IL-1RAPL1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDT LLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES
    • Amino acids
      151 to 250
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • IL 1 RAPL 1
    • IL 1RAPL 1
    • IL-1-RAPL-1
    • IL-1RAPL-1
    • IL1R8
    • IL1RAPL
    • IL1RAPL 1
    • IL1RAPL-1
    • IL1RAPL1
    • Interleukin 1 receptor 8
    • Interleukin 1 receptor accessory protein like 1
    • Interleukin-1 receptor accessory protein-like 1
    • IRPL1_HUMAN
    • Mental retardation X linked 10
    • Mental retardation X linked 21
    • Mental retardation X linked 34
    • MRX 21
    • MRX 34
    • MRX10
    • MRX21
    • MRX34
    • Oligophrenin 4
    • Oligophrenin-4
    • Oligophrenin4
    • OPHN 4
    • OPHN4
    • Three immunoglobulin domain containing IL 1 receptor related 2
    • Three immunoglobulin domain-containing IL-1 receptor-related 2
    • TIGIRR 2
    • TIGIRR-2
    • TIGIRR2
    • X linked interleukin 1 receptor accessory protein like 1
    • X-linked interleukin-1 receptor accessory protein-like 1
    see all
  • Function
    May regulate secretion and presynaptic differentiation through inhibition of the activity of N-type voltage-gated calcium channel. May activate the MAP kinase JNK.
  • Tissue specificity
    Detected at low levels in heart, skeletal muscle, ovary, skin, amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra and thalamus. Detected at very low levels in tonsil, prostate, testis, small intestine, placenta, colon and fetal liver.
  • Involvement in disease
    Defects in IL1RAPL1 are the cause of mental retardation X-linked type 21 (MRX21) [MIM:300143]. Mental retardation is a mental disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Non-syndromic mental retardation patients do not manifest other clinical signs.
  • Sequence similarities
    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization
    Cell membrane. Cytoplasm. May localize to the cell body and growth cones of dendrite-like processes.
  • Information by UniProt

Images

  • ab161315 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up