Description

  • Product name

    Recombinant human IL-2 protein (Animal Free)
    See all IL-2 proteins and peptides
  • Biological activity

    The ED50 determined by the dose-dependent stimulation of the proliferation of murine CTLL-2 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.

  • Purity

    > 98 % SDS-PAGE.
    > 98% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKK ATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGS ETTFMCEYADETATIVEFLNRWITFAQSIISTLT
    • Predicted molecular weight

      16 kDa
    • Amino acids

      21 to 153
    • Additional sequence information

      This product is the mature full length protein from aa 21 to 153. The signal peptide is not included. The 134 amino acid residue chain includes one intrachain disulfide bond.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab217411 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 3
    Constituent: 0.29% Sodium citrate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • Aldesleukin
    • IL 2
    • IL-2
    • IL2
    • IL2_HUMAN
    • Interleukin 2
    • Interleukin-2
    • interleukin2
    • Involved in regulation of T cell clonal expansion
    • Lymphokine
    • OTTHUMP00000164090
    • POIL2
    • T Cell Growth Factor
    • T-cell growth factor
    • TCGF
    see all
  • Function

    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease

    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities

    Belongs to the IL-2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab217411 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217411.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up