For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-il-2-receptor-alpha-protein-fc-chimera-ab84071.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Adaptive Immunity T Cells CD
Share by email

Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
  • SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
  • Functional Studies - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: SDS-PAGE

You may also be interested in

ELISA
Product image
Human IL-2 Receptor ELISA Kit (ab46036)

View more associated products

Description

  • Product name

    Recombinant human IL-2 Receptor alpha protein (Fc Chimera)
    See all IL-2 Receptor alpha proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

    P01589
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      Theoretical Sequence: ELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTG NSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVD QASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAE SVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSC LVTTTDFQIQTEMAATMETSIFTTGIPKVDKKVEPKSCDKTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNV FSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids

      22 to 237

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab84071 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Lyophilized
    • Additional notes

      ab84071 bound to protein A sepharose beads is able to pull down its ligand, IL2.
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

      Constituents: 1% Human serum albumin, 10% Trehalose

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

    General Info

    • Alternative names

      • Interleukin 2 receptor alpha chain
      • CD25
      • CD25 antigen
      • IDDM10
      • IL 2 receptor alpha subunit
      • IL-2 receptor subunit alpha
      • IL-2-RA
      • IL-2R subunit alpha
      • IL2 RA
      • IL2 Receptor alpha
      • IL2-RA
      • IL2R
      • IL2R, alpha chain
      • IL2RA
      • IL2RA_HUMAN
      • IMD41
      • Interleukin 2 receptor
      • Interleukin 2 receptor alpha
      • Interleukin-2 receptor subunit alpha
      • p55
      • t-cell growth factor receptor
      • TAC
      • TAC antigen
      • TCGFR
      see all
    • Function

      Receptor for interleukin-2.
    • Involvement in disease

      Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
    • Sequence similarities

      Contains 2 Sushi (CCP/SCR) domains.
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession P01589 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
      SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
      1D SDS-PAGE of ab84071 before and after treatment with glycosidases to remove oligosaccharides.
      Lane 1: ab84071
      Lane 2: ab84071 treated with PNGase F to remove potential N-linked glycans
      Lane 3: ab84071 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
      10 μg protein loaded per lane; Deep Purple™ stained.

      Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Subsequent tightening of band after treatment with glycosidase cocktail suggests presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes.
    • SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
      SDS-PAGE - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
      A sample of ab84071 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel.
      40μg protein loaded per lane; Deep Purple™ stained. Spot train indicates presence of multiple isoforms.
      Spots within the spot train were cut from the gel and identified as IL2 Receptor alpha (Fc Chimera) by protein mass fingerprinting.
    • Functional Studies - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
      Functional Studies - Recombinant human IL-2 Receptor alpha protein (Fc Chimera) (ab84071)
      Densitometry of protein isoforms visualised by 2-DE.
      The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
      The triangle indicates the theoretical MW and pI of the protein.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab84071? Please let us know so that we can cite the reference in this datasheet.

    ab84071 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab84071.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.