Recombinant Human IL-2 Receptor alpha protein (Fc Chimera His Tag) (ab223005)

Description

  • Product name

    Recombinant Human IL-2 Receptor alpha protein (Fc Chimera His Tag)
    See all IL-2 Receptor alpha proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab223005 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCT GNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQ ASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVC KMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTT DFQIQTEMAATMETSIFTTEYQLEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGKHHHHHH
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      22 to 240
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgGHis-tag at C-terminus (NP_000408).

Specifications

Our Abpromise guarantee covers the use of ab223005 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • Interleukin 2 receptor alpha chain
    • CD25
    • CD25 antigen
    • IDDM10
    • IL 2 receptor alpha subunit
    • IL-2 receptor subunit alpha
    • IL-2-RA
    • IL-2R subunit alpha
    • IL2 RA
    • IL2 Receptor alpha
    • IL2-RA
    • IL2R
    • IL2R, alpha chain
    • IL2RA
    • IL2RA_HUMAN
    • IMD41
    • Interleukin 2 receptor
    • Interleukin 2 receptor alpha
    • Interleukin-2 receptor subunit alpha
    • p55
    • t-cell growth factor receptor
    • TAC
    • TAC antigen
    • TCGFR
    see all
  • Function

    Receptor for interleukin-2.
  • Involvement in disease

    Genetic variations in IL2RA are associated with susceptibility to diabetes mellitus insulin-dependent type 10 (IDDM10) [MIM:601942]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
  • Sequence similarities

    Contains 2 Sushi (CCP/SCR) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab223005.

References

ab223005 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223005.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up