Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      VPCVSGGLPKPANITFLSINMKNVLQWTPPEGLQGVKVTYTVQYFIYGQK KWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKCSKWAESGRF YPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNL KYNVSVLNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRA QPSEKQCARTLKDQSSEFKAKVDHHHHHH
    • Molecular weight

      26 kDa including tags
    • Amino acids

      30 to 250
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Protein previously labeled as IL20 Receptor alpha.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • class II cytokine receptor ZCYTOR7
    • CRF2 8
    • CRF2-8
    • Cytokine receptor class II member 8
    • Cytokine receptor class-II member 8
    • Cytokine receptor family 2 member 8
    • I20RA_HUMAN
    • IL 20R alpha
    • IL 20R1
    • IL-20 receptor subunit alpha
    • IL-20R-alpha
    • IL-20R1
    • IL-20RA
    • IL20 Receptor alpha
    • IL20RA
    • Interleukin 20 receptor alpha chain
    • Interleukin 20 receptor, alpha
    • interleukin-20 receptor I
    • Interleukin-20 receptor subunit alpha
    • ZcytoR7
    see all
  • Function

    The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL20RA/IL10RB dimer is a receptor for IL26.
  • Tissue specificity

    Widely expressed with highest levels in skin and testis and high levels in brain. Highly expressed in psoriatic skin.
  • Sequence similarities

    Belongs to the type II cytokine receptor family.
    Contains 2 fibronectin type-III domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab152009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up