Recombinant human IL-20R2 protein (Fc Chimera) (ab179978)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human IL-20R2 protein (Fc Chimera)
See all IL-20R2 proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA.
When Recombinant Human IL19 protein is present at 0.2 µg/mL, the concentration of ab179978 that produces 50% of the optimal binding response is approximately 5-50 ng/ml. -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYT SHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKH PFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEH VKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE A -
Predicted molecular weight
49 kDa including tags -
Amino acids
30 to 230 -
Additional sequence information
Accession AAH63696. Fused with Fc fragment of Human IgG1 at the C-terminus.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab179978 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
Protein previously labeled as IL20RB.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Reconstitute for long term storage.
pH: 7.4
Constituents: 0.75% Glycine, 0.61% Tris, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 200 µg/ml.
General Info
-
Alternative names
- DIRS1
- Fibronectin type III domain containing 6
- FNDC6
see all -
Function
The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24. -
Tissue specificity
Widely expressed with highest levels in skin and testis. Highly expressed in psoriatic skin. -
Sequence similarities
Belongs to the type II cytokine receptor family.
Contains 2 fibronectin type-III domains. -
Cellular localization
Membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant human IL-20R2 protein (Fc Chimera) (ab179978)
SDS-PAGE analysis of reduced ab179978 stained overnight with Coomassie Blue.
Lane 1: DTT-reduced protein.
Lane 2: Non-reduced protein.
As a result of glycosylation, DTT-reduced Protein migrates as 50 kDa and non-reduced protein migrates as 100 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab179978 has not yet been referenced specifically in any publications.
