Description

  • Product name

    Recombinant human IL-23R protein (Fc Chimera)
    See all IL-23R proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQPRKLHFYKNGIKE RFQITRINKTTARLWYKNFLEPHASMYCTAECPKHFQETLICGKDISSGY PPDIPDEVTCVIYEYSGNMTCTWNAGKLTYIDTKYVVHVKSLETEEEQQY LTSSYINISTDSLQGGKKYLVWVQAANALGMEESKQLQIHLDDIVIPSAA VISRAETINATVPKTIIYWDSQTTIEKVSCEMRYKATTNQTWNVKEFDTN FTYVQQSEFYLEPNIKYVFQVRCQETGKRYWQPWSSLFFHKTPETVPQVT SKAFQHDTWNSGLTVASISTGHLTSDNRGD
    • Predicted molecular weight

      38 kDa
    • Amino acids

      24 to 353
    • Additional sequence information

      Fused to the N-terminus of the Fc region of Human IgG1 (NP_653302.2).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab214161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

    Lyophilized from 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.

General Info

  • Alternative names

    • IL 23R
    • IL-23 receptor
    • IL-23R
    • IL23 Receptor
    • Il23r
    • IL23R_HUMAN
    • Interleukin 23 receptor
    • Interleukin-23 receptor
    see all
  • Function

    Associates with IL12RB1 to form the interleukin-23 receptor. Binds IL23 and mediates T-cells, NK cells and possibly certain macrophage/myeloid cells stimulation probably through activation of the Jak-Stat signaling cascade. IL23 functions in innate and adaptive immunity and may participate in acute response to infection in peripheral tissues. IL23 may be responsible for autoimmune inflammatory diseases and be important for tumorigenesis.
  • Tissue specificity

    Expressed by monocytes, Th1, Th0, NK and dendritic cells. Isoform 1 is specifically expressed in NK cells.
  • Involvement in disease

    Genetic variations in IL23R are associated with inflammatory bowel disease type 17 (IBD17) [MIM:612261]. IBD17 is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to rectal and colonic mucosal layers; fistulas and granulomas are not observed. Both diseases include extraintestinal inflammation of the skin, eyes, or joints.
    Genetic variations in IL23R are a cause of susceptibility to psoriasis type 7 (PSORS7) [MIM:605606]. Psoriasis is a common, chronic inflammatory disease of the skin with multifactorial etiology. It is characterized by red, scaly plaques usually found on the scalp, elbows and knees. These lesions are caused by abnormal keratinocyte proliferation and infiltration of inflammatory cells into the dermis and epidermis.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 2 fibronectin type-III domains.
  • Post-translational
    modifications

    Phosphorylated in response to IL23.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab214161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up