Description

  • Product name

    Recombinant Human IL-28A protein (His tag)
    See all IL-28A proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRC HSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQ PLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLE ASVTFNLFRLLTRDLNCVASGDLCVHHHHHH
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      26 to 200
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab215639 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O.

General Info

  • Alternative names

    • Cytokine ZCYTO20
    • IFN-lambda-2
    • IFNL2
    • IL-28A
    • IL28A
    • IL28A_HUMAN
    • Interferon lambda 2
    • Interferon lambda-2
    • Interleukin 28A
    • interleukin 28A (interferon, lambda 2)
    • Interleukin-28A
    • ZCYTO20
    see all
  • Function

    Cytokine with immunomodulatory activity. Up-regulates MHC class I antigen expression. Displays potent antiviral activity. Also displays antitumor activity. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.
  • Sequence similarities

    Belongs to the IL-28/IL-29 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab215639 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215639.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up