Description

  • Product name

    Recombinant human IL-29 protein
    See all IL-29 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The ED50 is determined in an anti-viral assay using Human HepG2 cells infected with encephalomyocarditis is typically 1-5 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    ab200263 is >97% pure as determined by SDS-PAGE and HPLC analyses.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPV FPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLH HILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFN LFRLLTRDLKYVADGNLCLRTSTHPEST
    • Predicted molecular weight

      20 kDa
    • Amino acids

      23 to 200

Specifications

Our Abpromise guarantee covers the use of ab200263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.4
    Constituents: 0.75% Sodium chloride, 99% Phosphate Buffer

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • Cytokine ZCYTO21
    • IFN lambda 1
    • IFN-lambda-1
    • IFNL1
    • IL-29
    • IL29
    • IL29_HUMAN
    • Interferon lambda 1
    • Interferon lambda-1
    • Interleukin 29 (interferon, lambda 1)
    • Interleukin-29
    see all
  • Function

    Cytokine with immunomodulatory activity. May play a role in antiviral immunity. Up-regulates MHC class I antigen expression. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.
  • Sequence similarities

    Belongs to the IL-28/IL-29 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab200263 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up