Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIK DGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
    • Molecular weight

      16 kDa
    • Amino acids

      20 to 152
    • Additional sequence information

      This product is the mature full length protein from aa 20 to 152. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab217412 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Purity

    > 98 % SDS-PAGE.
    > 98% by HPLC analysis.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • Colony stimulating factor multiple
    • Hematopoietic growth factor
    • IL 3
    • IL-3
    • IL3
    • IL3_HUMAN
    • Interleukin 3
    • Interleukin 3 (colony stimulating factor, multiple)
    • Interleukin-3
    • Mast cell growth factor
    • MCGF
    • MGC79398
    • MGC79399
    • Multi CSF
    • Multilineage colony stimulating factor
    • Multipotential colony stimulating factor
    • Multipotential colony-stimulating factor
    • OTTHUMP00000065963
    • P cell stimulating factor
    • P-cell-stimulating factor
    see all
  • Function

    Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
    This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
  • Tissue specificity

    Activated T-cells, mast cells, natural killer cells.
  • Sequence similarities

    Belongs to the IL-3 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab217412 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217412.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up