Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLL SYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKP LPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTE NILFKLSET
    • Molecular weight

      50 kDa including tags
    • Amino acids

      112 to 270
    • Additional sequence information

      Corresponding to the extracellular domain of human IL33 (aa 112-270), fused to the N-terminus of the Fc region of human IgG1.

Specifications

Our Abpromise guarantee covers the use of ab216186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 5.000 Eu/mg
  • Purity

    >= 98 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Stable for 12 months at -20°C.

    Constituent: 100% PBS

    Lyophilized from 0.2µm-filtered solution

  • Reconstitution
    Reconstitute 50µg vial in 50µl sterile water to a concentration of 1mg/ml. Add 1X PBS to the desired protein concentration. Stable for at least 1 year after receipt when stored at -20°C. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • C9orf26
    • CHROMOSOME 9 OPEN READING FRAME 26
    • DKFZp586H0523
    • DVS27
    • DVS27 related protein
    • IL 1F11
    • IL 33
    • IL-1F11
    • IL-33
    • IL1F11
    • IL33
    • IL33_HUMAN
    • Interleukin 1 family member 11
    • Interleukin 33
    • INTERLEUKIN 33 NFHEV
    • Interleukin 33 precursor
    • Interleukin-1 family member 11
    • Interleukin-33 (109-270)
    • Interleukin33
    • NF HEV
    • NF-HEV
    • NFEHEV
    • NFHEV
    • Nuclear factor for high endothelial venules
    • Nuclear factor from high endothelial venules
    • OTTHUMP00000021041
    • RP11 575C20.2
    see all
  • Function

    Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells (PubMed:16286016). Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury (PubMed:17853410, PubMed:18836528).
    In quiescent endothelia the uncleaved form is constitutively and abundantly expressed, and acts as a chromatin-associated nuclear factor with transcriptional repressor properties, it may sequester nuclear NF-kappaB/RELA, lowering expression of its targets (PubMed:21734074). This form is rapidely lost upon angiogenic or proinflammatory activation (PubMed:18787100).
  • Tissue specificity

    Expressed at high level in high endothelial venules found in tonsils, Peyer patches and mesenteric lymph nodes. Almost undetectable in placenta.
  • Sequence similarities

    Belongs to the IL-1 family. Highly divergent.
  • Domain

    The homeodomain-like HTH domain mediates nuclear localization and heterochromatin association.
  • Post-translational
    modifications

    The full length protein can be released from cells and is able to signal via the IL1RL1/ST2 receptor. However, proteolytic processing by CSTG/cathepsin G and ELANE/neutrophil elastase produces C-terminal peptides that are more active than the unprocessed full length protein. May also be proteolytically processed by calpains (PubMed:19596270). Proteolytic cleavage mediated by apoptotic caspases including CASP3 and CASP7 results in IL33 inactivation (PubMed:19559631). In vitro proteolytic cleavage by CASP1 was reported (PubMed:16286016) but could not be confirmed in vivo (PubMed:19465481) suggesting that IL33 is probably not a direct substrate for that caspase.
  • Cellular localization

    Nucleus. Chromosome. Cytoplasmic vesicle, secretory vesicle. Secreted. Associates with heterochromatin and mitotic chromosomes (PubMed:17185418).
  • Information by UniProt

References

ab216186 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up