Description

  • Product name

    Recombinant Human IL-34 protein
    See all IL-34 proteins and peptides
  • Biological activity

    Measured by its ability to induce secretion of MCP-1 from PBMCs.

  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% by SDS-PAGE gel and HPLC analyses.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFR VMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSP SSPPHSTGSVRPVRAQGEGLLPHHHHHHHH
    • Predicted molecular weight

      53 kDa
    • Amino acids

      21 to 242
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Interleukin 34.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 3.00
    Constituents: 0.44% Sodium chloride, 0.52% Sodium citrate

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml for extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA)

General Info

  • Alternative names

    • C16orf77
    • Chromosome 16 open reading frame 77
    • FPT025
    • IL 34
    • IL-34
    • Il34
    • IL34_HUMAN
    • Interleukin 34
    • Interleukin-34
    • Interleukin34
    • MGC34647
    see all
  • Function

    Cytokine that promotes the differentiation and viability of monocytes and macrophages. Stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Ligand for colony-stimulating factor-1 receptor CSF1R.
  • Tissue specificity

    Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small intestine, prostate and colon.
  • Sequence similarities

    Belongs to the IL-34 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab109933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up