Description

  • Product name

    Recombinant Human IL-34 protein (His tag)
    See all IL-34 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP YEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWK YLQEVQTLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDN CFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPP WSPSSPPHSTGSVRPVRAQGEGLLPHHHHHH
    • Amino acids

      21 to 242
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 21 to 242. The signal peptide is not included (NP_689669).

Specifications

Our Abpromise guarantee covers the use of ab234967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Interleukin 34.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.50
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.87% Sodium chloride, 0.002% PMSF, 0.03% EDTA, 30% Glycerol

General Info

  • Alternative names

    • C16orf77
    • Chromosome 16 open reading frame 77
    • FPT025
    • IL 34
    • IL-34
    • Il34
    • IL34_HUMAN
    • Interleukin 34
    • Interleukin-34
    • Interleukin34
    • MGC34647
    see all
  • Function

    Cytokine that promotes the differentiation and viability of monocytes and macrophages. Stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Ligand for colony-stimulating factor-1 receptor CSF1R.
  • Tissue specificity

    Detected in the sinusoidal epithelium in the red pulp of spleen (at protein level). Predominantly expressed in spleen. Also detected in a range of other tissues including heart, brain, lung, liver, kidney, thymus, testis, ovary, small intestine, prostate and colon.
  • Sequence similarities

    Belongs to the IL-34 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab234967.

    MW: 28-40 kDa (SDS-PAGE under reducing conditions).

References

ab234967 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234967.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up