Recombinant Human IL-36RN protein (ab151905)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human IL-36RN protein
See all IL-36RN proteins and peptides -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWL DASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTF YRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFY FQQCD -
Predicted molecular weight
17 kDa -
Amino acids
1 to 155
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab151905 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
pH: 7.50
Constituents: 0.32% Tris HCl, 0.88% Sodium chloride -
ReconstitutionLyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
General Info
-
Alternative names
- AI413231
- Family of interleukin 1 delta
- FIL1
see all -
Function
Is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response. -
Tissue specificity
Predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. -
Involvement in disease
Defects in IL36RN are the cause of psoriasis generalized pustular (PSORP) [MIM:614204]. PSORP is a life-threatening disease defined by repeated flares of sudden onset consisting of diffuse erythematous skin eruption characterized by rapid coverage with pustules, high-grade fever, asthenia, marked leukocytosis, and elevated serum levels of C-reactive protein. -
Sequence similarities
Belongs to the IL-1 family. -
Cellular localization
Secreted. - Information by UniProt
Datasheets and documents
References
ab151905 has not yet been referenced specifically in any publications.
