Recombinant Human IL-36RN protein (ab151905)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human IL-36RN protein
See all IL-36RN proteins and peptides -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWL DASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTF YRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFY FQQCD -
Predicted molecular weight
17 kDa -
Amino acids
1 to 155
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab151905 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
pH: 7.50
Constituents: 0.32% Tris HCl, 0.88% Sodium chloride -
ReconstitutionLyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
General Info
-
Alternative names
- AI413231
- Family of interleukin 1 delta
- FIL1
see all -
Function
Is a highly and a specific antagonist of the IL-1 receptor-related protein 2-mediated response to interleukin 1 family member 9 (IL1F9). Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response. -
Tissue specificity
Predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin. -
Involvement in disease
Defects in IL36RN are the cause of psoriasis generalized pustular (PSORP) [MIM:614204]. PSORP is a life-threatening disease defined by repeated flares of sudden onset consisting of diffuse erythematous skin eruption characterized by rapid coverage with pustules, high-grade fever, asthenia, marked leukocytosis, and elevated serum levels of C-reactive protein. -
Sequence similarities
Belongs to the IL-1 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab151905 has not yet been referenced specifically in any publications.