Recombinant human IL-4 protein (ab155733)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant human IL-4 protein
See all IL-4 proteins and peptides -
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceHEK 293 cells
-
Amino Acid Sequence
-
Accession
-
SpeciesHuman
-
SequenceHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAAT VLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCP VKEANQSTLENFLERLKTIMREKYSKCSS
-
Molecular weight15 kDa
-
Amino acids25 to 153
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab155733 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Biological activity
Immobilized Human IL-4, Tag Free at 5 μg/mL (100 μL/well)can bind Human IL-4 R alpha, Fc Tag with a linear range of 1-20 ng/mL
-
Applications
Functional Studies
SDS-PAGE
-
Endotoxin level< 1.000 Eu/µg
-
Purity>95% by SDS-PAGE .
ab155733 was lyophilised from 0.22 µm filtered solution. -
FormLyophilised
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 6.00
Constituents: 0.39% MES, 5% Trehalose, 1.17% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- B cell growth factor 1
- B cell IgG differentiation factor
- B Cell Stimulatory Factor 1
see all -
FunctionParticipates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
-
Involvement in diseaseGenetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
-
Sequence similaritiesBelongs to the IL-4/IL-13 family.
-
Cellular localizationSecreted.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant human IL-4 protein (ab155733)SDS-PAGE analysis of reduced ab155733 stained overnight with Coomassie Blue.
Datasheets and documents
References
ab155733 has not yet been referenced specifically in any publications.
