Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAA TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC PVKEANQSTLENFLERLKTIMREKYSKCSS
    • Molecular weight

      15 kDa
    • Amino acids

      25 to 153

Specifications

Our Abpromise guarantee covers the use of ab222347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a cell proliferation assay using TF1 human erythroleukemic cells. The ED50 for this effect is less or equal to 0.6 ng/ml.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab222347 was purified by conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • B cell growth factor 1
    • B cell IgG differentiation factor
    • B Cell Stimulatory Factor 1
    • B-cell stimulatory factor 1
    • BCGF 1
    • BCGF1
    • Binetrakin
    • BSF-1
    • BSF1
    • IGG1 induction factor
    • IL 4
    • IL-4
    • IL4
    • IL4_HUMAN
    • Il4e12
    • Interleukin 4
    • Interleukin 4 variant 2
    • Interleukin 4, isoform 1
    • Interleukin-4
    • Lymphocyte stimulatory factor 1
    • MGC79402
    • Pitrakinra
    see all
  • Function

    Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
  • Involvement in disease

    Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant mouse IL4 protein (ab222347 at 3 µg)

References

This product has been referenced in:

  • Liu Z  et al. TGF-ß1 secreted by M2 phenotype macrophages enhances the stemness and migration of glioma cells via the SMAD2/3 signalling pathway. Int J Mol Med 42:3395-3403 (2018). Read more (PubMed: 30320350) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up