Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEETFCRAAT VLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCP VKEANQSTLENFLERLKTIMREKYSKCSS
    • Molecular weight

      15 kDa
    • Amino acids

      25 to 153
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab217413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 was determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is ≤ 0.2 ng/mL, corresponding to a specific activity of ≥ 5 x 106 units/mg.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Purity

    > 98 % SDS-PAGE.
    > 98% by HPLC analysis.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • B cell growth factor 1
    • B cell IgG differentiation factor
    • B Cell Stimulatory Factor 1
    • B-cell stimulatory factor 1
    • BCGF 1
    • BCGF1
    • Binetrakin
    • BSF-1
    • BSF1
    • IGG1 induction factor
    • IL 4
    • IL-4
    • IL4
    • IL4_HUMAN
    • Il4e12
    • Interleukin 4
    • Interleukin 4 variant 2
    • Interleukin 4, isoform 1
    • Interleukin-4
    • Lymphocyte stimulatory factor 1
    • MGC79402
    • Pitrakinra
    see all
  • Function

    Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.
  • Involvement in disease

    Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similarities

    Belongs to the IL-4/IL-13 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab217413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up