Description

  • Product name

    Recombinant Human IL-4 Receptor alpha protein
    See all IL-4 Receptor alpha proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCI PENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRA PGNLTVHTNV
    • Amino acids

      26 to 135
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • IL4 binding protein
    • IL4 BP
    • IL4 Receptor alpha
    • sIL4Ralpha
    • Soluble interleukin 4 receptor alpha chain
    see all
  • Relevance

    IL-4 Receptor alpha (IL-4RA) is the alpha chain of the interleukin 4 receptor which binds to both interleukin 4 and interleukin 13 to regulate IgE production, chemokine and mucus production at sites of allergic inflammmation. The IL4 response is involved in promoting Th2 differentiation. The secreted extracellular domain of IL-4R alpha, called sIL4R alpha, can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. It has no signaling abilities. Allelic variations in the IL-4RA gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema.
  • Cellular localization

    Cell membrane; single-pass type I membrane protein. Isoform 2: Secreted protein.

Images

  • ab158758 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up