Recombinant human IL-4R protein (ab167726)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human IL-4R protein
See all IL-4R proteins and peptides -
Biological activity
Measured by its ability to inhibit IL4-dependent proliferation of TF1 Human erythroleukemic cells. Approximately 253 ng/mL of ab167726 will inhibit 50% of the biological response due to 0.2 ng/mL of rhIL4. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCI PENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRA PGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIY NVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSY REPFEQH -
Predicted molecular weight
25 kDa including tags -
Amino acids
26 to 232 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab167726 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 99% PBS
Normally Mannitol or Trehalose are added as protectants before lyophilization.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- CD124
- IL 4R alpha
- IL-4 receptor subunit alpha
see all -
Function
Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammmation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells. -
Tissue specificity
Isoform 1 and isoform 2 are highly expressed in activated T-cells. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Contains 1 fibronectin type-III domain. -
Domain
The extracellular domain represents the IL4 binding protein (IL4BP).
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases. -
Post-translational
modificationsOn IL4 binding, phosphorylated on C-terminal tyrosine residues. Phosphorylation on any one of tyrosine residues, Tyr-575, Tyr-603 or Tyr-631, is required for STAT6-induced gene induction.
The soluble form (sIL4R/IL4BP) can also be produced by proteolytic cleavage at the cell surface (shedding) by a metalloproteinase. -
Cellular localization
Secreted and Cell membrane. - Information by UniProt
Images
-
Reducing (R) conditions SDS-PAGE of His Tagged Human IL-4 R alpha. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
The purity of ab167726 was more than 85% and the molecular weight of this protein is around 32-48 kDa verified by SEC-MALS.
-
Immobilized ab167726 at 5µg/mL (100 µL/well) can bind Biotinylated Human IL-4, Avitag, His Tag with a linear range of 2-16 ng/mL.
-
Serial dilutions of Monoclonal IL-4R/CD124 Neutralizing Antibody were added into Human IL-4 R alpha, His Tag (Ab167726): Biotinylated Human IL-4, Avitag, His Tag binding reactions. The half maximal inhibitory concentration (IC50) is 0.505 μg/mL (Routinely tested).
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab167726 has not yet been referenced specifically in any publications.