Description

  • Product name

    Recombinant human IL-4R protein
    See all IL-4R proteins and peptides
  • Biological activity

    The expected ED50 of ≤ 5.0 ng/ml, corresponding to a specific activity of ≥ 2 x 105 units/mg, is measured by determining the ability to inhibit the IL-4 dependent proliferation of human TF-1 cells while in the presence of 0.5 ng/ml IL-4.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHT CIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKP RAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFR IYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHN SYREPFEQH
    • Amino acids

      24 to 232
    • Additional sequence information

      This construct corresponds to the extracellular domain.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab222954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to a concentration of 0.1-1.0 mg/ml.

General Info

  • Alternative names

    • CD124
    • IL 4R alpha
    • IL-4 receptor subunit alpha
    • IL-4-binding protein
    • IL-4R subunit alpha
    • IL-4R-alpha
    • IL-4RA
    • IL4-BP
    • Il4r
    • IL4R nirs variant 1
    • IL4RA
    • IL4RA_HUMAN
    • Interleukin 4 receptor
    • Interleukin 4 receptor alpha chain
    • sIL4Ralpha/prot
    • Soluble IL-4 receptor subunit alpha
    • Soluble IL-4R-alpha
    • Soluble interleukin-4 receptor subunit alpha
    see all
  • Function

    Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammmation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
    Soluble IL4R (sIL4R) inhibits IL4-mediated cell proliferation and IL5 up-regulation by T-cells.
  • Tissue specificity

    Isoform 1 and isoform 2 are highly expressed in activated T-cells.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The extracellular domain represents the IL4 binding protein (IL4BP).
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Post-translational
    modifications

    On IL4 binding, phosphorylated on C-terminal tyrosine residues. Phosphorylation on any one of tyrosine residues, Tyr-575, Tyr-603 or Tyr-631, is required for STAT6-induced gene induction.
    The soluble form (sIL4R/IL4BP) can also be produced by proteolytic cleavage at the cell surface (shedding) by a metalloproteinase.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab222954 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up