Description

  • Product name

    Recombinant Human IL-5RA protein
    See all IL-5RA proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKIN APKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYF LYYRYGSWTEECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSK HSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEKPVSAFPIHCF DYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAG LWSEWSQPIYVGNDE
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      21 to 335
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_000555).

Specifications

Our Abpromise guarantee covers the use of ab221341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD125
    • CD125 antigen
    • CDw125
    • HSIL5R3
    • IL-5 receptor subunit alpha
    • IL-5R subunit alpha
    • IL-5R-alpha
    • IL-5RA
    • IL5R
    • IL5RA
    • IL5RA_HUMAN
    • Interleukin 5 Receptor alpha
    • Interleukin 5 Receptor alpha chain
    • Interleukin 5 receptor alpha subunit
    • Interleukin 5 receptor subunit alpha
    • Interleukin 5 receptor type 3
    • Interleukin-5 receptor subunit alpha
    • MGC26560
    see all
  • Function

    This is the receptor for interleukin-5. The alpha chain binds to IL5.
  • Tissue specificity

    Expressed on eosinophils and basophils.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 5 subfamily.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE (DTT reduced) analysis of ab221341 followed by staining overnight with Coomassie Blue. The reduced protein migrates as 45-55 kDa in SDS-PAGE due to glycosylation.

References

ab221341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up