Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMC ESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEY LQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTK LQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
    • Molecular weight
      21 kDa
    • Amino acids
      29 to 212

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Determined by its ability to stimulate the proliferation of the IL-6 dependent mouse 7TD1 cells.The expected ED50 is ≤0.1 ng/mL, corresponding to a specific activity of ≥ 1 x 107 units/mg.

  • Applications

    SDS-PAGE

    Functional Studies

    Neutralising

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 98 % SDS-PAGE.
    Sterile filtered. Greater than 98% pure by SDS-PAGE and HPLC analyses.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute on arrival. Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-0.5 mg/ml. For longer term storage follow reconstitution with further dilution in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots.

General Info

  • Alternative names
    • Interleukin BSF 2
    • B cell differentiation factor
    • B cell stimulatory factor 2
    • B-cell stimulatory factor 2
    • BSF 2
    • BSF-2
    • BSF2
    • CDF
    • CTL differentiation factor
    • Hepatocyte stimulatory factor
    • HGF
    • HSF
    • Hybridoma growth factor
    • Hybridoma growth factor Interferon beta-2
    • IFN-beta-2
    • IFNB2
    • IL 6
    • IL-6
    • IL6
    • IL6_HUMAN
    • Interferon beta 2
    • Interferon beta-2
    • Interleukin 6
    • Interleukin 6 (interferon beta 2)
    • Interleukin BSF 2
    • Interleukin-6
    see all
  • Function
    Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.
  • Involvement in disease
    Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ) [MIM:604302]. An inflammatory articular disorder with systemic-onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis.
    Note=A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men.
  • Sequence similarities
    Belongs to the IL-6 superfamily.
  • Post-translational
    modifications
    N- and O-glycosylated.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab9627 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer



Dieses Protein muss in 5-10mM Essigsäure (Acetic acid) aufgenommen werden damit eine volle Solubilisierung gewährleistet werden kann. Wir empfehlen eine Endkonzentration des Proteins von 0.1-0.5 mg/ml.

Danach kann es weiter mit PBS oder jedem anderen wässrige Puffer verdünnt werden. Das sollte den pH dann auch wieder auf physiologische Ebene zurückbringen

Nach dem Verdünnen empfehlen wir das Protein zu aliquotieren und bei -80C zu lagern, da das Protein aktiv ist.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up