Recombinant human IL-6R protein (ab167742)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant human IL-6R protein
See all IL-6R proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceHEK 293 cells
-
Amino Acid Sequence
-
Accession
-
SpeciesHuman
-
SequenceLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGS HPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQL SCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQ ESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPP ANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWM VKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESR SPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP
-
Molecular weight40 kDa including tags
-
Amino acids20 to 365
-
TagsHis tag N-Terminus
-
Associated products
-
Positive Controls
Specifications
Our Abpromise guarantee covers the use of ab167742 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Biological activityMeasured by its ability to enhance the IL6 activity on M1 mouse myeloid leukemia cells. The ED50 for this effect is typically 15-60 ng/ml.
-
Applications
Functional Studies
SDS-PAGE
-
Endotoxin level< 1.000 Eu/µg
-
Purity> 90 % SDS-PAGE.
ab167742 was lyophilized from 0.22 µm filtered solution. -
FormLyophilised
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 94% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 250 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- CD 126
- CD126
- CD126 antigen
see all -
FunctionPart of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Low concentration of a soluble form of IL6 receptor acts as an agonist of IL6 activity. -
Tissue specificityIsoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
-
Sequence similaritiesBelongs to the type I cytokine receptor family. Type 3 subfamily.
Contains 1 fibronectin type-III domain.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain. -
DomainThe two fibronectin type-III-like domains, contained in the N-terminal part, form together a cytokine-binding domain.
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding. -
Post-translational
modificationsA short soluble form may also be released from the membrane by proteolysis. -
Cellular localizationSecreted and Basolateral cell membrane.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant human IL-6R protein (ab167742)SDS-PAGE analysis of reduced ab167742 and staining overnight with Coomassie Blue. Protein migrates as 60-70 kDa in reduced SDS-PAGE resulting from glycosylation.
Datasheets and documents
References
ab167742 has not yet been referenced specifically in any publications.
