Description

  • Product name

    Recombinant human IL-7 protein (Fc Chimera)
    See all IL-7 proteins and peptides
  • Biological activity

    The Fc-protein was measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is typically 10-100ng/ml.

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

    < 0.060 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDAN KEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRK PAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH
    • Predicted molecular weight

      17 kDa
    • Amino acids

      26 to 177
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included. It is fused to the N-terminus of the Fc portion of a mutant Human IgG1 (AAH47698.1).

Specifications

Our Abpromise guarantee covers the use of ab214592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Stable for 12 months at -20°C.

    Constituent: PBS

    0.2µm-filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute vial in 50 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.

General Info

  • Alternative names

    • IL 7
    • IL-7
    • Il7
    • IL7_HUMAN
    • Interleukin 7
    • Interleukin-7
    • LP-1
    • Lymphopoietin 1
    see all
  • Function

    Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation.
  • Sequence similarities

    Belongs to the IL-7/IL-9 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab214592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up