Overview

  • Product name

    Recombinant Human IL-9R protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHLGSNCCKNGQTLLQRTCHGVSCCGWWFQAARSILGKGPSAQSLAGWTL ESEALRRDMGTWLLACICICTCVCLGVSVTGEGQGPRSRTFTCLTNNILR IDCHWSAPELGQGSSPWLLFTRLLAAHISASCGAVSAPSCCHLRQCSCHL TISPSLSTTACLGGSRSAWWTRSTCPGDTSNISSGHCILTWSISPALEPM TTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDPGFIHEARLR VQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLV AVSIFLLLTGPTYLLFKLSPRLGWGPTGPVCC
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 332

Specifications

Our Abpromise guarantee covers the use of ab132052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD129
    • IL-9 receptor
    • IL-9R
    • Il9r
    • IL9R_HUMAN
    • IL9RX
    • IL9RY
    • Interleukin 9 receptor
    • Interleukin-9 receptor
    see all
  • Function

    This is a receptor for interleukin-9.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization

    Cell membrane. Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132052 stained with Coomassie Blue.

References

ab132052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up