Recombinant Human IL1 Receptor I / IL-1R-1 protein (ab158755)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVS TEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENE PNLCYNAQAI
    • Amino acids
      18 to 127
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen CD121a
    • CD121 antigen-like family member A
    • CD121a
    • CD121a antigen
    • D2S1473
    • IL 1
    • IL 1R 1
    • IL 1R alpha
    • IL 1RT1
    • IL-1R-1
    • IL-1R-alpha
    • IL-1RT-1
    • IL-1RT1
    • IL1 inhibitor
    • IL1 Receptor I
    • IL1R
    • IL1R1
    • IL1R1_HUMAN
    • IL1RA
    • IL1RN
    • IL1RT1
    • Interleukin 1 receptor alpha type 1
    • Interleukin 1 receptor antagonist protein (IRAP)
    • Interleukin 1 receptor type I
    • Interleukin receptor 1
    • Interleukin-1 receptor alpha
    • Interleukin-1 receptor type 1
    • Interleukin-1 receptor type I
    • p80
    see all
  • Function
    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1RA). Binding to the agonist leads to the activation of NF-kappa-B. Signaling involves formation of a ternary complex containing IL1RAP, TOLLIP, MYD88, and IRAK1 or IRAK2.
  • Sequence similarities
    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 TIR domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158755 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up