Recombinant human IL1 Receptor II protein (ab174069)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSP RINLTWHKND SARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTR NASYCDKMSIELRVFENTDAFL PFISYPQILTLSTSGVLVCPDLSEFT RDKTDVKIQWYKDSLLLDKDNEKFLSVRGTTHLL VHDVALEDAGYYRC VLTFAHEGQQYNITRSIELRIKKKKEETIPVIISPLKTISASLGSR LT IPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSENNENY IEVPLIFD PVTREDLHMDFKCVVHNTLSFQTLRTTVKE
    • Molecular weight
      39 kDa including tags
    • Amino acids
      14 to 343
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain. (Accession # NP_004624.1).

Specifications

Our Abpromise guarantee covers the use of ab174069 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to inhibit IL1 beta dependent proliferation in D10.G4.1 mouse helper T cells.
    Approximately 0.5-3 µg/ml of ab174069 will inhibit 50% of the biological response due to 50 pg/ml of recombinant Human IL1 beta.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    > 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. . After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C. Aliquot to avoid repeated freeze-thaw cycles.

General Info

  • Alternative names
    • IL1 Receptor II
    • Antigen CDw121b
    • CD121
    • CD121 antigen-like family member B
    • CD121b
    • CD121B Antigen
    • CDw121b
    • IL 1 type II receptor
    • IL-1R-2
    • IL-1R-beta
    • IL-1R2
    • IL-1RT-2
    • IL-1RT2
    • IL1R Beta
    • Il1r-2
    • IL1R2
    • IL1R2_HUMAN
    • IL1R2c
    • IL1RB
    • Interleukin 1 receptor type II variant 3
    • Interleukin 1 receptor, beta, type II
    • Interleukin 1 receptor, type II
    • Interleukin-1 receptor beta
    • Interleukin-1 receptor type 2
    • Interleukin-1 receptor type II
    • MGC137383
    • MGC47725
    • OTTHUMP00000207969
    • p68
    • Type II interleukin-1 receptor, beta
    see all
  • Function
    Receptor for interleukin-1 alpha (IL-1A), beta (IL-1B), and interleukin-1 receptor antagonist protein (IL-1ra).
  • Sequence similarities
    Belongs to the interleukin-1 receptor family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab174069 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 50-55 kDa due to glycosylation.

References

ab174069 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174069.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up