Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSP WNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLR REPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
    • Amino acids
      24 to 155
    • Tags
      His tag N-Terminus
    • Additional sequence information
      IL-17A exists in vitro as a homodimer of two 132 amino acid chains.

Specifications

Our Abpromise guarantee covers the use of ab166882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    Constituent: 50% Glycerol
    Note: Buffered with PBS or Tris.

General Info

  • Alternative names
    • CTLA 8
    • CTLA-8
    • CTLA8
    • cytotoxic T lymphocyte associated antigen 8
    • Cytotoxic T lymphocyte associated protein 8
    • Cytotoxic T lymphocyte associated serine esterase 8
    • Cytotoxic T-lymphocyte-associated antigen 8
    • IL 17
    • IL 17A
    • IL-17
    • IL-17A
    • IL17
    • IL17_HUMAN
    • Il17a
    • Interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8)
    • interleukin 17A
    • Interleukin-17A
    • OTTHUMP00000016597
    see all
  • Function
    Induces stromal cells to produce proinflammatory and hematopoietic cytokines. Enhances the surface expression of the intracellular adhesion molecule-1 (ICAM-1) in fibroblasts.
  • Tissue specificity
    Restricted to activated memory T-cells.
  • Sequence similarities
    Belongs to the IL-17 family.
  • Post-translational
    modifications
    Found both in glycosylated and nonglycosylated forms.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

The molecular weight of ab166882, including the tag and linker, is 19.62 kDa.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up