Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMQPRSPKSKRKGQGRPGPLAPGPHQV PLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNK RSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFS QVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
    • Molecular weight
      20 kDa including tags
    • Amino acids
      21 to 180
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156976 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Cytokine like protein Zcyto7
    • Cytokine Zcyto7
    • IL 17B
    • IL 20
    • IL-17B
    • IL-20
    • IL17B
    • IL17B_HUMAN
    • IL20
    • Interleukin 17 beta
    • Interleukin 17B
    • Interleukin 20
    • Interleukin-17B
    • Interleukin-20
    • MGC138900
    • MGC138901
    • Neuronal interleukin 17 related factor
    • Neuronal interleukin-17-related factor
    • NIRF
    • ZCYTO7
    see all
  • Function
    Stimulates the release of tumor necrosis factor alpha and IL-1-beta from the monocytic cell line THP-1.
  • Tissue specificity
    Expressed in adult pancreas, small intestine, stomach, spinal cord and testis. Less pronounced expression in prostate, colon mucosal lining, and ovary.
  • Sequence similarities
    Belongs to the IL-17 family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156976 (3µg).

References

ab156976 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156976.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up