Recombinant Human IL17B Receptor protein (ab163120)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMN VSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGG
    • Amino acids
      18 to 117
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163120 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRL 4
    • CRL4
    • Cytokine receptor CRL4
    • EVI 27
    • EVI27
    • IL 17 receptor B
    • IL 17 receptor homolog 1
    • IL 17B receptor
    • IL 17RB
    • IL 17Rh1
    • IL17BR
    • IL17RB
    • IL17RH1
    • Interleukin 17 receptor B
    • Interleukin 17 receptor homolog
    • Interleukin 17 receptor homolog 1
    • Interleukin 17B receptor
    • MGC5245
    see all
  • Relevance
    Recently, a number of cytokines belonging to the interleukin IL17 family have been identified. These are termed as IL17B, IL17C and IL17E. IL17 is a potent proinflammatory cytokine that plays roles in a number of diseases including rheumatoid arthritis, multiple sclerosis, and promotion of tumor growth. IL17B, C, and E like IL17 are able to induce proinflammatory responses. However, they do not bind to the IL17 receptor suggesting that additional IL17R related receptor might exist. Receptor for IL17B and IL17E have been independently isolated and have been designated as EV127 (in mouse) and IL17RH1 (in human), respectively. IL17E induces activation of NFkB pathway and like IL17 also induces production of IL8. IL17RH1 mRNA is highly expressed in Kidney and liver and at moderate level in small intestine, colon, and brain.
  • Cellular localization
    Type I membrane protein (isoform 1). Secreted (isoform 2).

Images

  • ab163120 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163120 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163120.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up